616 results
Oral communication religion resources for staff and administrators
Christian Character Awards - EDITABLE - For Elementary School
These editable Christian Character awards are perfect for your preschool and early elementary students and are made with Christian education in mind. Celebrate your student's social-emotional growth and workmanship from a biblical worldview! Each award has a biblical theme and verse to recognize each of your unique little ones and their giftings. Use them for weekly or monthly recognition, or for end of the year awards.What's included?32 awards for preschool, kindergarten or early elementary
Grades:
Not Grade Specific
Also included in: Christian Character Awards BUNDLE
Common Core Rules for Discussion {Speak Up!} Speaking & Listening 1.a
You'll need the latest version of Adobe to read this PDF file: http://get.adobe.com/flashplayer/
Not only are speaking and listening skills one fifth of the Common Core standards for ELA, and not only cooperation and collaboration included in the line-up of skills for 21st century education...the tools and skills needed to have and hold intelligent conversations with others is an essential life skill. Every grade level, K-5 includes the speaking and listening standard of "having collaborative
Grades:
K - 5th
Voice-O-Meter Voice Chart
These SUPER USEFUL VOICE-O-METERS can be used with general education or special education students. They are GREAT VISUAL CUES for teaching or reminding students about indoor/outdoor voice. ***************************************************Teachers and Speech-Language Pathologists will find using these voice-o-meters make teaching this skill fun and easy. And the multiple sizes are perfect for different areas on the school campus. I have had a lot of success using these with my students who e
Grades:
PreK - 12th, Staff
Podcast Response One-Pager and Booklet | List of Podcasts for the ELA Classroom
Printable one-pager and booklet response sheets for any podcast episode, plus 17 interesting podcasts for student listening in your ELA classroom - ideal for middle and high school!This list features recommendations from currently practising ELA teachers, and will expand as more great educational and supplementary shows are discovered.Want the BUNDLE? Check out my $15 Speaking & Listening BUNDLE of Communication, Discussion, and Presentation Activities!Note:This list of podcasts comes from t
Grades:
Not Grade Specific
DAYC-2 Automatic Score Calculator (Developmental Assessment) Instant results!
No more flipping through norms tables! Automatically find percentile ranks, scaled scores, and grade/age equivalencies. For the DAYC-2 Assessment (Developmental Assessment of Young Children-Second Edition). Includes ALL five domains and a visual analysis of each score. Now in Google Looker Studio format!Tired of scanning norms tables? Instantly turn those raw scores into percentiles and scaled scores! You are too valuable to be wasting time with busy-work that a computer can do.Other Assessmen
Grades:
PreK - K
Bible Stories - Elisha The Prophet Clip Art Bundle {Educlips Clipart}
A collection of images based on this story of Elisha The Prophet.
The images in this set are: Elisha, Elisha pointing to river, Naaman, Naaman traveling, Naaman bathing, Naaman cured, servant girl, river.
16 images (8 in color and the same 8 in B&W)
This set is also available (at a big discount) as part of the BIBLE STORIES 1 MEGA BUNDLE
This set contains all of the images shown.
Images saved at 300dpi in PNG files.
For personal or commercial use.
CLICK HERE for TERMS OF USE
This is a
Subjects:
Grades:
Not Grade Specific
Certificates - Sunday School
Enclosed is a set of certificates for your Sunday/Bible School students. The set contains 6 full size certificates to include: PromotionAttendance (2) Books of the BibleTen Commandments Bible VersesThey are fillable, just click and type in the included text boxes. Personalize, print and present! It's that easy. A resource that can be used forever, just fill and print over and over again.Make sure you have PowerPoint installed on your computer in order to edit the file. Vacation Bible School Cer
Subjects:
Grades:
Not Grade Specific
Classroom Awards with Bible Verses NIV
These fun FULL COLOR certificates can be used to celebrate academic success as well as praise character qualities in students. Use throughout the year or as your end of the year celebrations! The best part about these certificates is they are aligned with specific verses from the Bible (NIV). Each character quality and some academic certificates are imprinted with a Bible verse which will encourage students to continue on their path as they follow the Lord's guidance.
Awards Included:
*Promot
Grades:
K - 2nd
Christian Character Awards - EDITABLE - For upper elementary
These editable Christian Character awards are perfect for students of any age and are made with Christian education in mind. Celebrate your student's social-emotional growth and workmanship from a biblical worldview! Each award has a biblical theme and verse to recognize each of your unique students and their giftings. Use them for weekly or monthly recognition, or for end of the year awards.What's included?39 awards based on Biblical role models, books, and Christ-like attributes.Each award
Grades:
Not Grade Specific
Also included in: Christian Character Awards BUNDLE
CELF-5 Automatic Score Calculator (Language Fundamentals) Instant results!
No more flipping through norms tables! Automatically find percentile ranks, scaled scores, and grade/age equivalencies. For the CELF-5 Assessment (Clinical Evaluation of Language Fundamentals). Instantly turn those raw scores into percentiles, scaled scores, and age equivalencies! You are too valuable to be wasting time with busy-work that a computer can do.Other Assessment Tools Available:Words Their WayGORT-5PAT-2 & PAT-2(NU)DIBELSAcadience Reading & MathCTOPP-2TOWRE-2DAYC-2KLPA-3
Subjects:
Grades:
Not Grade Specific
Danielson Domain 3B Discussion and Questioning Techniques Flashcards
This Omega English product helps students engage in classroom and group discussion and assists teachers in reaching a high rating in the Danielson 3B component (Discussion and Questioning). Please note that this package particularly focuses on guiding students to asking probing or clarifying questions during discussions (there are other aspects of Danielson 3B Domain available in my store). The package contains 20 vibrant Seeking Clarification Flashcards. Each card contains a phrase that the
Grades:
3rd - 12th, Higher Education
Catholic Eucharist Bookmarks
Eucharist bookmarks by Ingrid's Art. Four different designs on one sheet. Copy on card stock for lasting bookmarks. Part of the Catholic First Eucharist Activity Booklet by Ingrid's Art.
Subjects:
Grades:
1st - 4th
Communication cards / Selective Mutism Resources / Communication and Speaking
These printable communication cards are perfect for children and teens who are non-verbal or struggle with speaking at times e.g. Autism, Selective Mutism, Learning Disabilities, Hearing Impaired, etc. The file consists of 168 pre-made cards in total, plus a blank template sheet to write or draw your own cards. These are colorful using different characters to help children and young adults to help express their needs better. Scroll down to see the range of needs and wants that are covered in t
Grades:
Not Grade Specific
Critical Thinking Language Sentence Frames {Say What?} Aligned to Common Core
***I'm pleased to share that as of September 2013, these Critical Thinking Language Frames (along with my Reading Interventions "If/Then" Menu) were selected for inclusion as a professional learning resource in the Smarter Balanced Assessment Consortium Digital Library. Read more about it here.***
You'll need the latest version of Adobe to read this PDF file: http://get.adobe.com/flashplayer/
Get all your students into the highest levels of Revised Bloom's Taxonomy (RBT) today with these lang
Grades:
K - 12th
BSHM Teacher Handouts
Celebrate Better Speech and Hearing Month with these informative handouts for teachers. Generate awareness of BSHM by posting these handouts in the lounge or circulating one in teachers' mailboxes each week.
This packet covers three distinct domains within the SLP's scope of practice:
(1) Language and Articulation Development
(2) Vocal Health and Hygiene (geared towards teachers)
(3) Fluency (stuttering)
Handouts are black and white, requiring low ink.
*Remember to write in your name at
Grades:
PreK - 5th
Christian Character Awards BUNDLE
These editable Christian Character awards are perfect for your students and are made with Christian education in mind. Celebrate your student's social-emotional growth and workmanship from a biblical worldview! Each award has a biblical theme and verse to recognize each of your unique students and their giftings. This bundle is perfect for Christian school administrators, principals, and church children's pastors who would like to recognize students of all ages.What's included? Early Elementary
Grades:
Not Grade Specific
INTRO | Buddhism (Printables Bundle)
This Printable Poster / Flashcard includes:✓ Clear + Organized + Stylized Content✓ FREE RESOURCES LINKED BELOW (including BONUS 7 Dimensions CARD +)✓ ANIMATED VERSIONS of each printableTopic & Details:EASTERN PHILOSOPHY - BuddhismRelated Content:Teaching Religion (FREE POSTER)Studying Religion (PPT)Philosophy of Religion (COMPLETE - PPT Bundle)World Religions (COMPLETE - PPT Bundle)Rebeka Ferreira's Content:✓ Like & Subscribe on YouTube✓ Follow Rebeka on Pinterest✓ FREE Educational Resou
Grades:
Not Grade Specific
Rock-Paper-Scissors Poster: A Visual Guide
ROCK-PAPER-SCISSORS-.....!
Have you ever needed a “visual” to help reinforce your instruction on how to play Rock-Paper-Scissors? RPS is a great decision making game of wits, speed, dexterity and strategy for students to use to decide small disputes or to settle ties/draws. It is also a FUN game to use for fitness-based games in the gym and activities in the classroom. It also works as a great tool for giving students problem solving skills without repeated, direct teacher intervention.
The p
Grades:
K - 11th
7 Dimensions | World Religions (POSTER | FLASHCARD)
This FREE Printable Poster / Flashcard includes:✓ Clear + Organized + Stylized Content✓ FREE RESOURCES LINKED BELOW✓ ANIMATED VERSIONTopic & Details: Comparing Major World ReligionsExplore the 7 Dimensions of:Indigenous ReligionsZoroastrianismHinduismBuddhismConfucianismDaoismJudaismChristianityIslamSikhismBaha'iNew Age SpiritualityRelated Content:Teaching Religion (FREE POSTER)Studying Religion (PPT)Philosophy of Religion (COMPLETE - PPT Bundle)World Religions (COMPLETE - PPT Bundle)Rebeka
Grades:
Not Grade Specific
EDITABLE End of the Year Notes/Certificates for Christian School Teachers!
And whatever you do, whether in word or deed, do it all in the name of the Lord Jesus, giving thanks to God the Father through him.Colossians 3:17Use these notes/certificates as an end of the year acknowledgement or any time you want to praise your students! The fun rainbow (and sun) watercolor designs are cheerful and bright, but black and white versions of every design are included, just in case. :)All the 1/2 and full page versions read: "I'm proud of you! I'm thankful for your hard work and
Subjects:
Grades:
PreK - 12th, Higher Education, Adult Education, Staff
School Morning Announcements
If your school provides morning announcements via intercom, this is the perfect template to get started. It's large print so the kids can hold it as they conduct the announcements. Change it up to meet the needs and ages of your school community. ENJOY!
Grades:
1st - 6th
BULLY BE KIND BE COOL Early Reader Literacy Circle
This interactive “BE KIND BE COOL” book & activity packet will give you and your students lots of opportunities to work on vocabulary, receptive and expressive language skills, following directions, answering WH and YES/NO questions, describing, and TONS MORE!***************************************************Teachers and Speech-Language Pathologists will find using these stories make teaching these skills fun and easy. **************************************************This book can be used
Grades:
PreK - 6th, Staff
How to Communicate with Your Teen
Communication can always be a tricky thing but communicating with your teen can feel like an impossible challenge at times. Between stressors, changing relationships, and hormones to top it off, teens can struggle knowing how and when to communicate well.Join Riley, a licensed Clinical Counselor with an emphasis in Childhood and Adolescent Behavioral Disorders to gain understanding, practical tools and insight of how you as a parent, teacher or caregiver can empower your teen to practice and lea
Grades:
Not Grade Specific
Virtue Display Cards | for Catholic Schools | Religion Posters
Elevate the values and virtues within your Catholic School with the Virtue Display Cards. This comprehensive set includes 33 beautifully designed virtue cards and 2 mounting sheets, specially designed to inspire and engage your students, staff, and school community.This resource includes: 33 Virtue Cardsrespectthankfulnessjusticepatiencewisdomresponsibilitycompassionforgivenessstewardshiptolerancehonestyempathyintegrityreverenceacceptancehopetruthfamilyservicehospitalityservicepeace-makingcharit
Subjects:
Grades:
Not Grade Specific
Showing 1-24 of 616 results
TPT is the largest marketplace for PreK-12 resources, powered by a community of educators.
IXL family of brands