736 results
Critical thinking religion resources for staff and administrators
Sponsored
Literacy Night Open House Make and Take - Parent Involvement 3rd, 4th, 5th
Involve your upper elementary students and their parents with fun and simple projects they can use at home at your next Open House, Curriculum Evening, or Literacy Night! A Make-and-Take night gives them an immediate tool they can use at home to support essential literacy skills. Perfect for a diverse class in upper elementary, as it can be tailored to suit your school. In this packet, I walk you through the planning of a literacy event at your school, whether you are inviting just your class, o
Grades:
3rd - 5th, Staff
Revised Bloom's Taxonomy Posters for Higher Level Thinking
Whether you're a Common Core school, a 21st Century school, or just a school that's making it a focus to prepare all learners for their future, you know how essential it is for the teaching and learning to be in the highest levels of Bloom's everyday. Display these student-friendly (and not too overwhelming) posters in your classroom (or if you're an administrator, purchase these for all the teachers in your building, so there's a set in every classroom) to help you and the students do "the wor
Grades:
K - 12th, Higher Education, Staff
Christian Character Awards - EDITABLE - For Elementary School
These editable Christian Character awards are perfect for your preschool and early elementary students and are made with Christian education in mind. Celebrate your student's social-emotional growth and workmanship from a biblical worldview! Each award has a biblical theme and verse to recognize each of your unique little ones and their giftings. Use them for weekly or monthly recognition, or for end of the year awards.What's included?32 awards for preschool, kindergarten or early elementary
Grades:
Not Grade Specific
Also included in: Christian Character Awards BUNDLE
The Blooms Bunch: Kid-Friendly Revised Bloom's Taxonomy Posters
Get your students' minds to bloom into higher-order thinking with The Blooms Bunch: Kid-Friendly Revised Bloom's Taxonomy Posters. Introduce your students to a character for each higher-order thinking level:
The Big Sibs: (Higher-Order Thinking Levels)
Create: Christie the Creator
Evaluate: Evan the Evaluator
Analyze: Anna the Analyzer
The Lil' Sibs: (Lower-Order Thinking Levels)
Apply: Adam the Applier
Understand: Ursula the one who Understands
Remember: Robert the one who Remembers
Print
Grades:
1st - 7th
Depth and Complexity Quick Guide Ebook | Learn the Depth and Complexity Icons
Do you love Depth and Complexity and need a quick guide to how to use it in class? Have you seen the Depth & Complexity icons and wondered how to use them? This Depth and Complexity Quick Guide E-book will be a time saver (and maybe even a lifesaver!!). You'll get a two-page, attractive spread for all eleven thinking prompts and one-page guides to all of the Content Imperatives.Depth & Complexity doesn't have to be overwhelming.Do any of these sound familiar?You love Depth & Complexi
Grades:
2nd - 12th, Staff
Also included in: Depth and Complexity Ebook BUNDLE | Question Stems and Quick Guide
Webb's Depth of Knowledge Common Core Classroom Posters
Whether you're a Common Core school, a 21st Century school, or just a school that's making it a focus to prepare all learners for their future, you know how essential it is for the teaching and learning to be in the highest levels of thinking everyday. Display these student-friendly (and not too overwhelming) posters in your classroom (or if you're an administrator, purchase these for all the teachers in your building, so there's a set in every classroom) to help you and the students do "the wo
Grades:
K - 12th, Higher Education, Staff
Bible Stories - Elisha The Prophet Clip Art Bundle {Educlips Clipart}
A collection of images based on this story of Elisha The Prophet.
The images in this set are: Elisha, Elisha pointing to river, Naaman, Naaman traveling, Naaman bathing, Naaman cured, servant girl, river.
16 images (8 in color and the same 8 in B&W)
This set is also available (at a big discount) as part of the BIBLE STORIES 1 MEGA BUNDLE
This set contains all of the images shown.
Images saved at 300dpi in PNG files.
For personal or commercial use.
CLICK HERE for TERMS OF USE
This is a
Subjects:
Grades:
Not Grade Specific
Certificates - Sunday School
Enclosed is a set of certificates for your Sunday/Bible School students. The set contains 6 full size certificates to include: PromotionAttendance (2) Books of the BibleTen Commandments Bible VersesThey are fillable, just click and type in the included text boxes. Personalize, print and present! It's that easy. A resource that can be used forever, just fill and print over and over again.Make sure you have PowerPoint installed on your computer in order to edit the file. Vacation Bible School Cer
Subjects:
Grades:
Not Grade Specific
Classroom Awards with Bible Verses NIV
These fun FULL COLOR certificates can be used to celebrate academic success as well as praise character qualities in students. Use throughout the year or as your end of the year celebrations! The best part about these certificates is they are aligned with specific verses from the Bible (NIV). Each character quality and some academic certificates are imprinted with a Bible verse which will encourage students to continue on their path as they follow the Lord's guidance.
Awards Included:
*Promot
Grades:
K - 2nd
Christian Character Awards - EDITABLE - For upper elementary
These editable Christian Character awards are perfect for students of any age and are made with Christian education in mind. Celebrate your student's social-emotional growth and workmanship from a biblical worldview! Each award has a biblical theme and verse to recognize each of your unique students and their giftings. Use them for weekly or monthly recognition, or for end of the year awards.What's included?39 awards based on Biblical role models, books, and Christ-like attributes.Each award
Grades:
Not Grade Specific
Also included in: Christian Character Awards BUNDLE
Depth of Knowledge Common Core Posters {Webb's DOK}
Critical Thinking, Common Core and DOK!
Webb's Depth of Knowledge (DOK) provides a frame of reference and vocabulary for students to understand how they engage with the content. DOK offers a common language to understand "rigor," or cognitive demand in all academic areas.
Print these colorful posters out and mount on construction paper. If you choose, laminate them for more durability. Have the students secure a set of individual size posters into their various academic notebooks, folders,
Grades:
PreK - 12th, Higher Education, Adult Education, Staff
Catholic Eucharist Bookmarks
Eucharist bookmarks by Ingrid's Art. Four different designs on one sheet. Copy on card stock for lasting bookmarks. Part of the Catholic First Eucharist Activity Booklet by Ingrid's Art.
Subjects:
Grades:
1st - 4th
Mardi Gras in New Orleans Social Studies Unit
Mardi Gras in New Orleans Social Studies Unit
Price: 77 pages X .10 = $7.70
This social studies unit delves into the unique holiday of Mardi Gras as experienced by a New Orleans native. It is a largely secular celebration with a religious history, in New Orleans, Louisiana, USA. The unit contains a plethora of activities, so you can decide how much time you would like to spend on it or tailor it to the time you have available. Below is the Table of Contents for the unit:
Special Teacher Dire
Grades:
2nd - 6th, Adult Education
Critical Thinking Language Sentence Frames {Say What?} Aligned to Common Core
***I'm pleased to share that as of September 2013, these Critical Thinking Language Frames (along with my Reading Interventions "If/Then" Menu) were selected for inclusion as a professional learning resource in the Smarter Balanced Assessment Consortium Digital Library. Read more about it here.***
You'll need the latest version of Adobe to read this PDF file: http://get.adobe.com/flashplayer/
Get all your students into the highest levels of Revised Bloom's Taxonomy (RBT) today with these lang
Grades:
K - 12th
Revised Bloom's Taxonomy Posters for Higher Level Thinking - UK/AUS/NZ Spelling
ATTENTION POTENTIAL BUYERS....****this is the UK/Australia version of my Revised Bloom's Taxonomy Posters, but with British and Australian spellings for the Bloom's Verbs... ANALYSE instead ANALYZE. I know how to spell. I have been asked to create these posters using British and Australian spellings of these verbs.****
Whether you're a 21st Century school or just a school that's making it a focus to prepare all learners for their future, you know how essential it is for the teaching and learn
Grades:
PreK - 12th, Higher Education, Adult Education, Staff
Christian Character Awards BUNDLE
These editable Christian Character awards are perfect for your students and are made with Christian education in mind. Celebrate your student's social-emotional growth and workmanship from a biblical worldview! Each award has a biblical theme and verse to recognize each of your unique students and their giftings. This bundle is perfect for Christian school administrators, principals, and church children's pastors who would like to recognize students of all ages.What's included? Early Elementary
Grades:
Not Grade Specific
INTRO | Buddhism (Printables Bundle)
This Printable Poster / Flashcard includes:✓ Clear + Organized + Stylized Content✓ FREE RESOURCES LINKED BELOW (including BONUS 7 Dimensions CARD +)✓ ANIMATED VERSIONS of each printableTopic & Details:EASTERN PHILOSOPHY - BuddhismRelated Content:Teaching Religion (FREE POSTER)Studying Religion (PPT)Philosophy of Religion (COMPLETE - PPT Bundle)World Religions (COMPLETE - PPT Bundle)Rebeka Ferreira's Content:✓ Like & Subscribe on YouTube✓ Follow Rebeka on Pinterest✓ FREE Educational Resou
Grades:
Not Grade Specific
7 Dimensions | World Religions (POSTER | FLASHCARD)
This FREE Printable Poster / Flashcard includes:✓ Clear + Organized + Stylized Content✓ FREE RESOURCES LINKED BELOW✓ ANIMATED VERSIONTopic & Details: Comparing Major World ReligionsExplore the 7 Dimensions of:Indigenous ReligionsZoroastrianismHinduismBuddhismConfucianismDaoismJudaismChristianityIslamSikhismBaha'iNew Age SpiritualityRelated Content:Teaching Religion (FREE POSTER)Studying Religion (PPT)Philosophy of Religion (COMPLETE - PPT Bundle)World Religions (COMPLETE - PPT Bundle)Rebeka
Grades:
Not Grade Specific
EDITABLE End of the Year Notes/Certificates for Christian School Teachers!
And whatever you do, whether in word or deed, do it all in the name of the Lord Jesus, giving thanks to God the Father through him.Colossians 3:17Use these notes/certificates as an end of the year acknowledgement or any time you want to praise your students! The fun rainbow (and sun) watercolor designs are cheerful and bright, but black and white versions of every design are included, just in case. :)All the 1/2 and full page versions read: "I'm proud of you! I'm thankful for your hard work and
Subjects:
Grades:
PreK - 12th, Higher Education, Adult Education, Staff
Bloom's Taxonomy {Posters and Student Resources} HOTS
This unit has been updated to now have the VERBS for Bloom's AND also a choice of backgrounds, to enhance star power in the classroom.
Focusing on the cognitive domain of development, Bloom's Taxonomy divides the important categories of thinking into levels from the lowest level (simple recall) to the highest level of thinking (evaluating). Encourage your students to become high level thinkers.
• Remembering
• Understanding
• Applying
• Analyzing
• Evaluating
• Creating
Print these colorfu
Grades:
PreK - 12th, Higher Education, Adult Education, Staff
Exit Tickets for Staff- Principals/Activity Leaders (Exit Slips for Assessment)
Need a quick way to receive some feedback, reflection, assessment, or maybe check on your staff climate? These exit slips are ready for immediate download and ready-to-print. Use for staff meetings, department meetings, PLC meetings…or place in staff mailboxes ANYTIME! Ready-to-go question prompts PLUS tickets to customize and add your own question prompts!INCLUDED IN THIS FILE: (PDF and PPTX included)*Twelve different questions (three tickets per page) six different color backgrounds*Four pages
Grades:
Staff
Virtue Display Cards | for Catholic Schools | Religion Posters
Elevate the values and virtues within your Catholic School with the Virtue Display Cards. This comprehensive set includes 33 beautifully designed virtue cards and 2 mounting sheets, specially designed to inspire and engage your students, staff, and school community.This resource includes: 33 Virtue Cardsrespectthankfulnessjusticepatiencewisdomresponsibilitycompassionforgivenessstewardshiptolerancehonestyempathyintegrityreverenceacceptancehopetruthfamilyservicehospitalityservicepeace-makingcharit
Subjects:
Grades:
Not Grade Specific
Growth Mindset Brain Facts Brochure
If you are teaching growth mindset in your classroom, then learning about the brain is a must. Use these Growth Mindset Brain Facts Brochures to talk all about the different parts of the brain and why having a growth mindset is important.What's included?There are 8 brochures to help teach about the brain!Your Amazing Brain A Learning BrainYour Growth Mindset Brain Your Cerebellum Your Frontal Lobe Your Temporal Lobe Your Occipital Lobe Your Parietal LobeBuy now and any additional brochures I mak
Subjects:
Grades:
2nd - 3rd
Also included in: Growth Mindset Brain Facts BUNDLE
Editable Christian Cross Easter Candy Gram Flyer | Scripture Bible Easter Gram
Looking for a unique and meaningful way to spread love this Easter? These editable Christian Cross Easter Candy Gram Flyer features a Bible Verse is perfect for you! Customize this fundraiser template to make your own Easter grams and share the joy of Easter in your school, church, or organization. **No printed materials will be shipped!--------------------------YOU WILL RECEIVE--------------------------All Edits are done on Canva only- Flyers: Editable Templates1 8.5 x 11 sheet2 5x7 Flyers on 8
Subjects:
Grades:
Not Grade Specific
Showing 1-24 of 736 results
TPT is the largest marketplace for PreK-12 resources, powered by a community of educators.
IXL family of brands